Class a: All alpha proteins [46456] (171 folds) |
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulphide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) |
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins) |
Protein Snake phospholipase A2 [48624] (19 species) |
Species Chinese water moccasin (Agkistrodon halys pallas), different isoforms [48628] (9 PDB entries) |
Domain d1bjjd_: 1bjj D: [19533] |
PDB Entry: 1bjj (more details), 2.8 Å
SCOP Domain Sequences for d1bjjd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bjjd_ a.133.1.2 (D:) Snake phospholipase A2 {Chinese water moccasin (Agkistrodon halys pallas), different isoforms} nllqfnkmikeetgknaipfyafygcycgwggqgkpkdgtdrccfvhdccygrlvncntk sdiysyslkegyitcgkgtnceeqicecdrvaaecfrrnldtynngymfyrdskctetse ec
Timeline for d1bjjd_: