SCOP 1.63: Domain d1bjjc_: 1bjj C:

Lineage for d1bjjc_ (1bjj C:)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulphide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)

6. Protein Snake phospholipase A2 [48624] (19 species)

7. Species Chinese water moccasin (Agkistrodon halys pallas), different isoforms [48628] (9 PDB entries)

8. Domain d1bjjc_: 1bjj C: [19532]

Details for d1bjjc_

PDB Entry: 1bjj, 2.8 Å

PDB Description: agkistrodotoxin, a phospholipase a2-type presynaptic neurotoxin from agkistrodon halys pallas

SCOP Domain Sequences for d1bjjc_:

Sequence; same for both SEQRES and ATOM records:

>d1bjjc_ a.133.1.2 (C:) Snake phospholipase A2 {Chinese water moccasin (Agkistrodon halys pallas), different isoforms}
nllqfnkmikeetgknaipfyafygcycgwggqgkpkdgtdrccfvhdccygrlvncntk
sdiysyslkegyitcgkgtnceeqicecdrvaaecfrrnldtynngymfyrdskctetse
ec

Timeline for d1bjjc_:

• d1bjjc_ first appeared (with stable ids) in SCOP 1.55
  
• d1bjjc_ appears in SCOP 1.61
  
• d1bjjc_ appears in SCOP 1.65
  
• d1bjjc_ appears in the current release, SCOPe 2.08