Lineage for d4f38b_ (4f38 B:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1111574Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1112047Family b.1.18.8: RhoGDI-like [81288] (3 proteins)
  6. 1112063Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (3 species)
  7. Species Mus musculus [TaxId:10090] [195317] (1 PDB entry)
  8. 1112099Domain d4f38b_: 4f38 B: [195318]
    Other proteins in same PDB: d4f38a_
    automated match to d1doab_
    complexed with ger, gnp, mg

Details for d4f38b_

PDB Entry: 4f38 (more details), 2.8 Å

PDB Description: Crystal structure of geranylgeranylated RhoA in complex with RhoGDI in its active GPPNHP-bound form
PDB Compounds: (B:) rho GDP-dissociation inhibitor 1

SCOPe Domain Sequences for d4f38b_:

Sequence, based on SEQRES records: (download)

>d4f38b_ b.1.18.8 (B:) Rho GDP-dissociation inhibitor 1, RhoGDI {Mus musculus [TaxId: 10090]}
taeqlaqiaaeneedehsvnykppaqksiqeiqeldkddeslrkykeallgrvavsadpn
vpnvvvtrltlvcstapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivsgm
kyiqhtyrkgvkidktdymvgsygpraeeyefltpmeeapkgmlargsyniksrftdddr
tdhlswewnltikkewkd

Sequence, based on observed residues (ATOM records): (download)

>d4f38b_ b.1.18.8 (B:) Rho GDP-dissociation inhibitor 1, RhoGDI {Mus musculus [TaxId: 10090]}
taeqlaqiaaenvnykppaqksiqeiqeldkddeslrkykeallgrvavsadpnvpnvvv
trltlvcstapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivsgmkyiqht
yrkgvkidktdymvgsygpraeeyefltpmeeapkgmlargsyniksrftdddrtdhlsw
ewnltikkewkd

SCOPe Domain Coordinates for d4f38b_:

Click to download the PDB-style file with coordinates for d4f38b_.
(The format of our PDB-style files is described here.)

Timeline for d4f38b_: