Lineage for d1bjjb_ (1bjj B:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 286043Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulphide-linked, and a calcium-binding loop
  4. 286044Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 286049Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)
  6. 286123Protein Snake phospholipase A2 [48624] (27 species)
  7. 286129Species Chinese water moccasin (Agkistrodon halys pallas), different isoforms [48628] (9 PDB entries)
  8. 286141Domain d1bjjb_: 1bjj B: [19531]

Details for d1bjjb_

PDB Entry: 1bjj (more details), 2.8 Å

PDB Description: agkistrodotoxin, a phospholipase a2-type presynaptic neurotoxin from agkistrodon halys pallas

SCOP Domain Sequences for d1bjjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bjjb_ a.133.1.2 (B:) Snake phospholipase A2 {Chinese water moccasin (Agkistrodon halys pallas), different isoforms}
nllqfnkmikeetgknaipfyafygcycgwggqgkpkdgtdrccfvhdccygrlvncntk
sdiysyslkegyitcgkgtnceeqicecdrvaaecfrrnldtynngymfyrdskctetse
ec

SCOP Domain Coordinates for d1bjjb_:

Click to download the PDB-style file with coordinates for d1bjjb_.
(The format of our PDB-style files is described here.)

Timeline for d1bjjb_: