Lineage for d3tzma_ (3tzm A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1929110Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1929111Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1929232Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1931405Protein Type I TGF-beta receptor R4 [56144] (1 species)
    TKL group; STKR subfamily; serine/threonine kinase; possible evolutionary link to tyrosine kinases
  7. 1931406Species Human (Homo sapiens) [TaxId:9606] [56145] (16 PDB entries)
    Uniprot P36897 200-500 ! Uniprot P36897 201-503
  8. 1931407Domain d3tzma_: 3tzm A: [195309]
    automated match to d1vjya_
    complexed with 085

Details for d3tzma_

PDB Entry: 3tzm (more details), 1.7 Å

PDB Description: TGF-beta Receptor type 1 in complex with SB431542
PDB Compounds: (A:) TGF-beta receptor type-1

SCOPe Domain Sequences for d3tzma_:

Sequence, based on SEQRES records: (download)

>d3tzma_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]}
tiartivlqesigkgrfgevwrgkwrgeevavkifssreerswfreaeiyqtvmlrheni
lgfiaadnkdngtwtqlwlvsdyhehgslfdylnrytvtvegmiklalstasglahlhme
ivgtqgkpaiahrdlksknilvkkngtcciadlglavrhdsatdtidiapnhrvgtkrym
apevlddsinmkhfesfkradiyamglvfweiarrcsiggihedyqlpyydlvpsdpsve
emrkvvceqklrpnipnrwqscealrvmakimrecwyangaarltalrikktlsqls

Sequence, based on observed residues (ATOM records): (download)

>d3tzma_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]}
tiartivlqesigkgrfgevwrgkwrgeevavkifssreerswfreaeiyqtvmlrheni
lgfiaadnkdngtwtqlwlvsdyhehgslfdylnrytvtvegmiklalstasglahlhme
ivgtqgkpaiahrdlksknilvkkngtcciadlglavrhdsatdtidiaprvgtkrymap
evlddsinmkhfesfkradiyamglvfweiarrcsiggihedyqlpyydlvpsdpsveem
rkvvceqklrpnipnrwqscealrvmakimrecwyangaarltalrikktlsqls

SCOPe Domain Coordinates for d3tzma_:

Click to download the PDB-style file with coordinates for d3tzma_.
(The format of our PDB-style files is described here.)

Timeline for d3tzma_: