SCOP 1.65: Domain d1jiab_: 1jia B:

Lineage for d1jiab_ (1jia B:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulphide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)

6. Protein Snake phospholipase A2 [48624] (27 species)

7. Species Chinese water moccasin (Agkistrodon halys pallas), different isoforms [48628] (9 PDB entries)

8. Domain d1jiab_: 1jia B: [19529]
   complexed with ca

Details for d1jiab_

PDB Entry: 1jia, 2.13 Å

PDB Description: structure of a basic phospholipase a2 from agkistrodon halys pallas at 2.13a resolution

SCOP Domain Sequences for d1jiab_:

Sequence; same for both SEQRES and ATOM records:

>d1jiab_ a.133.1.2 (B:) Snake phospholipase A2 {Chinese water moccasin (Agkistrodon halys pallas), different isoforms}
hllqfrkmikkmtgkepvvsyafygcycgsggrgkpkdatdrccfvhdccyekvtgcdpk
wddytyswkngtivcggddpckkevcecdkaaaicfrdnlktykkrymaypdilcsskse
kc

Timeline for d1jiab_:

• d1jiab_ first appeared (with stable ids) in SCOP 1.55
  
• d1jiab_ appears in SCOP 1.63
  
• d1jiab_ appears in SCOP 1.67
  
• d1jiab_ appears in the current release, SCOPe 2.08