Lineage for d4f8xa_ (4f8x A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1145288Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1146973Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 1146974Protein automated matches [190075] (30 species)
    not a true protein
  7. 1147035Species Penicillium canescens [TaxId:5083] [195263] (1 PDB entry)
  8. 1147036Domain d4f8xa_: 4f8x A: [195264]
    automated match to d1xyza_
    complexed with nag

Details for d4f8xa_

PDB Entry: 4f8x (more details), 1.47 Å

PDB Description: penicillium canescens endo-1,4-beta-xylanase xyle
PDB Compounds: (A:) endo-1,4-beta-xylanase

SCOPe Domain Sequences for d4f8xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f8xa_ c.1.8.0 (A:) automated matches {Penicillium canescens [TaxId: 5083]}
didlnklaqrrgkhwfgtaadipgtaettdaaylkvlkqnfgeitpanamkfmyteteqn
vfnftegeqflevaerfgskvrchnlvwasqvsdfvtsktwtakeltavmknhifktvqh
fgrrcyswdvvnealngdgtfsssvwydtigeeyfylafkyaqealaqigandvklyynd
ygienpgtkstavlqlvsnlrkrgiridgvgleshfivgetpsladqlatkqayikanld
vavteldvrfstvpyytaaaqkqqaedyyvsvascmnagprcigvvvwdfddayswvpsa
fagqggaclfnntleakpayyavadalegkpcsvc

SCOPe Domain Coordinates for d4f8xa_:

Click to download the PDB-style file with coordinates for d4f8xa_.
(The format of our PDB-style files is described here.)

Timeline for d4f8xa_: