Lineage for d3sjqd1 (3sjq D:415-490)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577229Fold f.15: Small-conductance potassium channel [81328] (1 superfamily)
    oligomeric transmembrane alpha-helical protein
  4. 2577230Superfamily f.15.1: Small-conductance potassium channel [81327] (1 family) (S)
  5. 2577231Family f.15.1.1: Small-conductance potassium channel [81326] (1 protein)
  6. 2577232Protein Small-conductance potassium channel [64528] (2 species)
  7. 2577233Species Norway rat (Rattus norvegicus) [TaxId:10116] [64529] (8 PDB entries)
  8. 2577237Domain d3sjqd1: 3sjq D:415-490 [195262]
    Other proteins in same PDB: d3sjqa_, d3sjqb_, d3sjqc2, d3sjqd2
    automated match to d1g4yb_
    complexed with ca, gol, phu, so4

Details for d3sjqd1

PDB Entry: 3sjq (more details), 1.9 Å

PDB Description: Crystal structure of a small conductance potassium channel splice variant complexed with calcium-calmodulin
PDB Compounds: (D:) Small conductance calcium-activated potassium channel protein 2

SCOPe Domain Sequences for d3sjqd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sjqd1 f.15.1.1 (D:415-490) Small-conductance potassium channel {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qltkrvknaaanvlretwliykntklvkkidhakvrkhqrkflqaihqarklrsvkmeqr
klndqantlvdlaktq

SCOPe Domain Coordinates for d3sjqd1:

Click to download the PDB-style file with coordinates for d3sjqd1.
(The format of our PDB-style files is described here.)

Timeline for d3sjqd1: