Lineage for d3sjqc1 (3sjq C:414-490)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2252831Fold f.15: Small-conductance potassium channel [81328] (1 superfamily)
    oligomeric transmembrane alpha-helical protein
  4. 2252832Superfamily f.15.1: Small-conductance potassium channel [81327] (1 family) (S)
  5. 2252833Family f.15.1.1: Small-conductance potassium channel [81326] (1 protein)
  6. 2252834Protein Small-conductance potassium channel [64528] (1 species)
  7. 2252835Species Norway rat (Rattus norvegicus) [TaxId:10116] [64529] (8 PDB entries)
  8. 2252840Domain d3sjqc1: 3sjq C:414-490 [195261]
    Other proteins in same PDB: d3sjqa_, d3sjqb_, d3sjqc2, d3sjqd2
    automated match to d1g4yb_
    complexed with ca, gol, phu, so4

Details for d3sjqc1

PDB Entry: 3sjq (more details), 1.9 Å

PDB Description: Crystal structure of a small conductance potassium channel splice variant complexed with calcium-calmodulin
PDB Compounds: (C:) Small conductance calcium-activated potassium channel protein 2

SCOPe Domain Sequences for d3sjqc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sjqc1 f.15.1.1 (C:414-490) Small-conductance potassium channel {Norway rat (Rattus norvegicus) [TaxId: 10116]}
tqltkrvknaaanvlretwliykntklvkkidhakvrkhqrkflqaihqarklrsvkmeq
rklndqantlvdlaktq

SCOPe Domain Coordinates for d3sjqc1:

Click to download the PDB-style file with coordinates for d3sjqc1.
(The format of our PDB-style files is described here.)

Timeline for d3sjqc1: