Lineage for d3sjqc_ (3sjq C:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1956734Fold f.15: Small-conductance potassium channel [81328] (1 superfamily)
    oligomeric transmembrane alpha-helical protein
  4. 1956735Superfamily f.15.1: Small-conductance potassium channel [81327] (1 family) (S)
  5. 1956736Family f.15.1.1: Small-conductance potassium channel [81326] (1 protein)
  6. 1956737Protein Small-conductance potassium channel [64528] (1 species)
  7. 1956738Species Norway rat (Rattus norvegicus) [TaxId:10116] [64529] (8 PDB entries)
  8. 1956743Domain d3sjqc_: 3sjq C: [195261]
    Other proteins in same PDB: d3sjqa_, d3sjqb_
    automated match to d1g4yb_
    complexed with ca, gol, phu, so4

Details for d3sjqc_

PDB Entry: 3sjq (more details), 1.9 Å

PDB Description: Crystal structure of a small conductance potassium channel splice variant complexed with calcium-calmodulin
PDB Compounds: (C:) Small conductance calcium-activated potassium channel protein 2

SCOPe Domain Sequences for d3sjqc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sjqc_ f.15.1.1 (C:) Small-conductance potassium channel {Norway rat (Rattus norvegicus) [TaxId: 10116]}
tqltkrvknaaanvlretwliykntklvkkidhakvrkhqrkflqaihqarklrsvkmeq
rklndqantlvdlaktqleh

SCOPe Domain Coordinates for d3sjqc_:

Click to download the PDB-style file with coordinates for d3sjqc_.
(The format of our PDB-style files is described here.)

Timeline for d3sjqc_: