SCOPe 2.06: Domain d4al8c_: 4al8 C:

Lineage for d4al8c_ (4al8 C:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins)

6. Protein automated matches [190183] (7 species)
   not a true protein

7. Species Dengue virus [TaxId:12637] [195242] (1 PDB entry)

8. Domain d4al8c_: 4al8 C: [195243]
   Other proteins in same PDB: d4al8l1, d4al8l2
   automated match to d2jsfa1
   complexed with gol

Details for d4al8c_

PDB Entry: 4al8, 1.66 Å

PDB Description: Structure of Dengue virus DIII in complex with Fab 2H12

PDB Compounds: (C:) envelope protein

SCOPe Domain Sequences for d4al8c_:

Sequence; same for both SEQRES and ATOM records:

>d4al8c_ b.1.18.4 (C:) automated matches {Dengue virus [TaxId: 12637]}
syvmctgsfklekevaetqhgtvlvqvkyegtdapckipfssqdekgvtqngrlitanpi
vtdkekpvnieaeppfgesyivvgagekalklswfkkg

Timeline for d4al8c_:

• d4al8c_ first appeared in SCOPe 2.02
  
• d4al8c_ appears in SCOPe 2.05
  
• d4al8c_ appears in SCOPe 2.07
  
• d4al8c_ appears in the current release, SCOPe 2.08