Lineage for d4alac_ (4ala C:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1111574Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1111941Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins)
  6. 1111986Protein automated matches [190183] (5 species)
    not a true protein
  7. 1111993Species Dengue virus 3 [TaxId:11069] [195240] (1 PDB entry)
  8. 1111994Domain d4alac_: 4ala C: [195241]
    automated match to d2jsfa1
    complexed with gol

Details for d4alac_

PDB Entry: 4ala (more details), 1.84 Å

PDB Description: Structure of Dengue virus DIII in complex with Fab 2H12
PDB Compounds: (C:) envelope protein

SCOPe Domain Sequences for d4alac_:

Sequence, based on SEQRES records: (download)

>d4alac_ b.1.18.4 (C:) automated matches {Dengue virus 3 [TaxId: 11069]}
amclntfvlkkevsetqhgtilikveykgedapckipfstedgqgkahngrlitanpvvt
kkeepvnieaeppfgesnivigigdkalkinw

Sequence, based on observed residues (ATOM records): (download)

>d4alac_ b.1.18.4 (C:) automated matches {Dengue virus 3 [TaxId: 11069]}
amclntfvlkkevsetqhgtilikveykgedapckipfstrlitanpvvtkkeepvniea
eppfgnivigikalkinw

SCOPe Domain Coordinates for d4alac_:

Click to download the PDB-style file with coordinates for d4alac_.
(The format of our PDB-style files is described here.)

Timeline for d4alac_: