SCOP 1.63: Domain d1pp2r_: 1pp2 R:

Lineage for d1pp2r_ (1pp2 R:)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulphide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)

6. Protein Snake phospholipase A2 [48624] (19 species)

7. Species Western diamondback rattlesnake (Crotalus atrox) [TaxId:8730] [48627] (1 PDB entry)

8. Domain d1pp2r_: 1pp2 R: [19524]

Details for d1pp2r_

PDB Entry: 1pp2, 2.5 Å

PDB Description: the refined crystal structure of dimeric phospholipase a2 at 2.5 angstroms. access to a shielded catalytic center

SCOP Domain Sequences for d1pp2r_:

Sequence; same for both SEQRES and ATOM records:

>d1pp2r_ a.133.1.2 (R:) Snake phospholipase A2 {Western diamondback rattlesnake (Crotalus atrox)}
slvqfetlimkiagrsgllwysaygcycgwgghglpqdatdrccfvhdccygkatdcnpk
tvsytyseengeiicggddpcgtqicecdkaaaicfrdnipsydnkywlfppkdcreepe
pc

Timeline for d1pp2r_:

• d1pp2r_ first appeared (with stable ids) in SCOP 1.55
  
• d1pp2r_ appears in SCOP 1.61
  
• d1pp2r_ appears in SCOP 1.65
  
• d1pp2r_ appears in the current release, SCOPe 2.08