SCOPe 2.06: Domain d4dd8d_: 4dd8 D:

Lineage for d4dd8d_ (4dd8 D:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.0: automated matches [191495] (1 protein)
   not a true family

6. Protein automated matches [190805] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188286] (43 PDB entries)

8. Domain d4dd8d_: 4dd8 D: [195236]
   automated match to d1r54a_
   complexed with bat, ca, cl, k, na, zn

Details for d4dd8d_

PDB Entry: 4dd8, 2.1 Å

PDB Description: ADAM-8 metalloproteinase domain with bound batimastat

PDB Compounds: (D:) Disintegrin and metalloproteinase domain-containing protein 8

SCOPe Domain Sequences for d4dd8d_:

Sequence; same for both SEQRES and ATOM records:

>d4dd8d_ d.92.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sretryvelyvvvdnaefqmlgseaavrhrvlevvnhvdklyqklnfrvvlvgleiwnsq
drfhvspdpsvtlenlltwqarqrtrrhlhdnvqlitgvdftgttvgfarvsamcshssg
avnqdhsknpvgvactmahemghnlgmdhdenvqgcrcqerfeagrcimagsigssfprm
fsdcsqaylesflerpqsvclanapdls

Timeline for d4dd8d_:

• d4dd8d_ first appeared in SCOPe 2.02
  
• d4dd8d_ appears in SCOPe 2.05
  
• d4dd8d_ appears in SCOPe 2.07
  
• d4dd8d_ appears in the current release, SCOPe 2.08