Lineage for d4dd8d_ (4dd8 D:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1660634Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1660635Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1661658Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 1661659Protein automated matches [190805] (12 species)
    not a true protein
  7. 1661678Species Human (Homo sapiens) [TaxId:9606] [188286] (26 PDB entries)
  8. 1661699Domain d4dd8d_: 4dd8 D: [195236]
    automated match to d1r54a_
    complexed with bat, ca, cl, k, na, zn

Details for d4dd8d_

PDB Entry: 4dd8 (more details), 2.1 Å

PDB Description: ADAM-8 metalloproteinase domain with bound batimastat
PDB Compounds: (D:) Disintegrin and metalloproteinase domain-containing protein 8

SCOPe Domain Sequences for d4dd8d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dd8d_ d.92.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sretryvelyvvvdnaefqmlgseaavrhrvlevvnhvdklyqklnfrvvlvgleiwnsq
drfhvspdpsvtlenlltwqarqrtrrhlhdnvqlitgvdftgttvgfarvsamcshssg
avnqdhsknpvgvactmahemghnlgmdhdenvqgcrcqerfeagrcimagsigssfprm
fsdcsqaylesflerpqsvclanapdls

SCOPe Domain Coordinates for d4dd8d_:

Click to download the PDB-style file with coordinates for d4dd8d_.
(The format of our PDB-style files is described here.)

Timeline for d4dd8d_: