Lineage for d4dd8a_ (4dd8 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1917420Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1917421Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1918487Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 1918488Protein automated matches [190805] (14 species)
    not a true protein
  7. 1918507Species Human (Homo sapiens) [TaxId:9606] [188286] (36 PDB entries)
  8. 1918528Domain d4dd8a_: 4dd8 A: [195234]
    automated match to d1r54a_
    complexed with bat, ca, cl, k, na, zn

Details for d4dd8a_

PDB Entry: 4dd8 (more details), 2.1 Å

PDB Description: ADAM-8 metalloproteinase domain with bound batimastat
PDB Compounds: (A:) Disintegrin and metalloproteinase domain-containing protein 8

SCOPe Domain Sequences for d4dd8a_:

Sequence, based on SEQRES records: (download)

>d4dd8a_ d.92.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
retryvelyvvvdnaefqmlgseaavrhrvlevvnhvdklyqklnfrvvlvgleiwnsqd
rfhvspdpsvtlenlltwqarqrtrrhlhdnvqlitgvdftgttvgfarvsamcshssga
vnqdhsknpvgvactmahemghnlgmdhdenvqgcrcqerfeagrcimagsigssfprmf
sdcsqaylesflerpqsvclanapd

Sequence, based on observed residues (ATOM records): (download)

>d4dd8a_ d.92.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
retryvelyvvvdnaefqmlgseaavrhrvlevvnhvdklyqklnfrvvlvgleiwnsqd
rfhvspdpsvtlenlltwqarrhlhdnvqlitgvdftgttvgfarvsamcshssgavnqd
hsknpvgvactmahemghnlgmdhdenvqgcrcqerfeagrcimagsigssfprmfsdcs
qaylesflerpqsvclanapd

SCOPe Domain Coordinates for d4dd8a_:

Click to download the PDB-style file with coordinates for d4dd8a_.
(The format of our PDB-style files is described here.)

Timeline for d4dd8a_: