Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) |
Family d.92.1.0: automated matches [191495] (1 protein) not a true family |
Protein automated matches [190805] (20 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188286] (69 PDB entries) |
Domain d4dd8a_: 4dd8 A: [195234] automated match to d1r54a_ complexed with bat, ca, cl, k, na, zn |
PDB Entry: 4dd8 (more details), 2.1 Å
SCOPe Domain Sequences for d4dd8a_:
Sequence, based on SEQRES records: (download)
>d4dd8a_ d.92.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} retryvelyvvvdnaefqmlgseaavrhrvlevvnhvdklyqklnfrvvlvgleiwnsqd rfhvspdpsvtlenlltwqarqrtrrhlhdnvqlitgvdftgttvgfarvsamcshssga vnqdhsknpvgvactmahemghnlgmdhdenvqgcrcqerfeagrcimagsigssfprmf sdcsqaylesflerpqsvclanapd
>d4dd8a_ d.92.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} retryvelyvvvdnaefqmlgseaavrhrvlevvnhvdklyqklnfrvvlvgleiwnsqd rfhvspdpsvtlenlltwqarrhlhdnvqlitgvdftgttvgfarvsamcshssgavnqd hsknpvgvactmahemghnlgmdhdenvqgcrcqerfeagrcimagsigssfprmfsdcs qaylesflerpqsvclanapd
Timeline for d4dd8a_: