Lineage for d4eaga_ (4eag A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538746Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2539572Superfamily d.129.6: KA1-like [103243] (3 families) (S)
    contains a single copy of this fold
  5. 2539614Family d.129.6.0: automated matches [195230] (1 protein)
    not a true family
  6. 2539615Protein automated matches [195231] (1 species)
    not a true protein
  7. 2539616Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [195232] (1 PDB entry)
  8. 2539617Domain d4eaga_: 4eag A: [195233]
    Other proteins in same PDB: d4eagc1, d4eagc2
    automated match to d2v92a_
    complexed with atp, tam

Details for d4eaga_

PDB Entry: 4eag (more details), 2.7 Å

PDB Description: Co-crystal structure of an chimeric AMPK core with ATP
PDB Compounds: (A:) EG:132E8.2 protein

SCOPe Domain Sequences for d4eaga_:

Sequence, based on SEQRES records: (download)

>d4eaga_ d.129.6.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
akwhlgirsqskpndimlevyramkalsyewkiinpyhvrvrrqnvktgkfskmslqlyq
vdaksylldfksltndeveqgddvimesltppplsvsgvmplqptghhtmeffemcaali
iqlar

Sequence, based on observed residues (ATOM records): (download)

>d4eaga_ d.129.6.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
akwhlgirsqskpndimlevyramkalsyewkiinpyhvrvrrqnvktgkfskmslqlyq
vdaksylldfksltlqptghhtmeffemcaaliiqlar

SCOPe Domain Coordinates for d4eaga_:

Click to download the PDB-style file with coordinates for d4eaga_.
(The format of our PDB-style files is described here.)

Timeline for d4eaga_: