![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
![]() | Superfamily c.8.7: RraA-like [89562] (2 families) ![]() structural similarity and possible distant homology to the phosphohistidine domain of pyruvate phosphate dikinase |
![]() | Family c.8.7.1: RraA-like [89563] (5 proteins) aka MenG-like; characterized as regulator of RNase E activity A (RraA) that globally modulates RNA abundance in E. coli automatically mapped to Pfam PF03737 |
![]() | Protein automated matches [195200] (1 species) not a true protein |
![]() | Species Escherichia coli [TaxId:83333] [195201] (1 PDB entry) |
![]() | Domain d2yjtb_: 2yjt B: [195202] automated match to d1q5xa_ protein/RNA complex |
PDB Entry: 2yjt (more details), 2.9 Å
SCOPe Domain Sequences for d2yjtb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yjtb_ c.8.7.1 (B:) automated matches {Escherichia coli [TaxId: 83333]} kydtselcdiyqedvnvveplfsnfggrasfggqiitvkcfedngllydlleqngrgrvl vvdgggsvrralvdaelarlavqneweglviygavrqvddleeldigiqamaaipvgaag egigesdvrvnfggvtffsgdhlyadntgiilsedpld
Timeline for d2yjtb_: