Lineage for d2yjtb_ (2yjt B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1352778Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 1353215Superfamily c.8.7: RraA-like [89562] (2 families) (S)
    structural similarity and possible distant homology to the phosphohistidine domain of pyruvate phosphate dikinase
  5. 1353216Family c.8.7.1: RraA-like [89563] (5 proteins)
    aka MenG-like; characterized as regulator of RNase E activity A (RraA) that globally modulates RNA abundance in E. coli
    automatically mapped to Pfam PF03737
  6. 1353238Protein automated matches [195200] (1 species)
    not a true protein
  7. 1353239Species Escherichia coli [TaxId:83333] [195201] (1 PDB entry)
  8. 1353241Domain d2yjtb_: 2yjt B: [195202]
    automated match to d1q5xa_
    protein/RNA complex

Details for d2yjtb_

PDB Entry: 2yjt (more details), 2.9 Å

PDB Description: crystal structure of e. coli dead-box protein srmb bound to regulator of ribonuclease activity a (rraa)
PDB Compounds: (B:) Regulator of ribonuclease activity A

SCOPe Domain Sequences for d2yjtb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yjtb_ c.8.7.1 (B:) automated matches {Escherichia coli [TaxId: 83333]}
kydtselcdiyqedvnvveplfsnfggrasfggqiitvkcfedngllydlleqngrgrvl
vvdgggsvrralvdaelarlavqneweglviygavrqvddleeldigiqamaaipvgaag
egigesdvrvnfggvtffsgdhlyadntgiilsedpld

SCOPe Domain Coordinates for d2yjtb_:

Click to download the PDB-style file with coordinates for d2yjtb_.
(The format of our PDB-style files is described here.)

Timeline for d2yjtb_: