Lineage for d2q2hb_ (2q2h B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2790411Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 2790412Protein automated matches [190576] (52 species)
    not a true protein
  7. 2790413Species Agrobacterium tumefaciens [TaxId:176299] [188408] (2 PDB entries)
  8. 2790417Domain d2q2hb_: 2q2h B: [195196]
    automated match to d2q2ia_
    complexed with act, cit

Details for d2q2hb_

PDB Entry: 2q2h (more details), 1.65 Å

PDB Description: Crystal structure of the protein secretion chaperone CsaA from Agrobacterium tumefaciens with a genetically fused phage-display derived peptide substrate at the N-terminus.
PDB Compounds: (B:) Secretion chaperone, phage-display derived peptide

SCOPe Domain Sequences for d2q2hb_:

Sequence, based on SEQRES records: (download)

>d2q2hb_ b.40.4.0 (B:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
geisyadfekvdirvgtiveavpfpearkpaikvkidfgpeigikkssaqitvhytpesl
vgrqvlgvvnfpprqigpfrsevltlgfadangdivlaaverpvpngekmc

Sequence, based on observed residues (ATOM records): (download)

>d2q2hb_ b.40.4.0 (B:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
geisyadfekvdirvgtiveavpfpaikvkidfgpeigikkssaqitvhytpeslvgrqv
lgvvnfpprqigpfrsevltlgfadangdivlaaverpvpngekmc

SCOPe Domain Coordinates for d2q2hb_:

Click to download the PDB-style file with coordinates for d2q2hb_.
(The format of our PDB-style files is described here.)

Timeline for d2q2hb_: