SCOPe 2.04: Domain d4aq1d_: 4aq1 D:

Lineage for d4aq1d_ (4aq1 D:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (19 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (76 PDB entries)

8. Domain d4aq1d_: 4aq1 D: [195193]
   automated match to d2xa3a_
   complexed with ca

Details for d4aq1d_

PDB Entry: 4aq1, 2.42 Å

PDB Description: Structure of the SbsB S-layer protein of Geobacillus stearothermophilus PV72p2 in complex with nanobody KB6

PDB Compounds: (D:) nbkb6

SCOPe Domain Sequences for d4aq1d_:

Sequence; same for both SEQRES and ATOM records:

>d4aq1d_ b.1.1.1 (D:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlqesggglvqaggslrlscaasgrtssayamgwfrqapgkerefvagisskggstyy
gasmkgrftisrdnakntvylqmnglapedtavyycaasdkynfdtshagygywgqgtqv
tvss

Timeline for d4aq1d_:

• d4aq1d_ first appeared in SCOPe 2.02
  
• d4aq1d_ appears in SCOPe 2.03
  
• d4aq1d_ appears in SCOPe 2.05
  
• d4aq1d_ appears in the current release, SCOPe 2.08, called d4aq1d1