Lineage for d4dcfa_ (4dcf A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732915Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2732916Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2732921Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2733305Protein automated matches [190139] (27 species)
    not a true protein
  7. 2733311Species Bothrops brazili [TaxId:157546] [195180] (2 PDB entries)
  8. 2733314Domain d4dcfa_: 4dcf A: [195185]
    automated match to d1xxsa_
    complexed with pg4

Details for d4dcfa_

PDB Entry: 4dcf (more details), 2.7 Å

PDB Description: Structure of MTX-II from Bothrops brazili
PDB Compounds: (A:) MTX-II chain A

SCOPe Domain Sequences for d4dcfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dcfa_ a.133.1.2 (A:) automated matches {Bothrops brazili [TaxId: 157546]}
slvelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltdcdpk
kdrysyswkdktivcgennsclkelcecdkavaiclrenldtynkkyrnnhlkpfckkad
pc

SCOPe Domain Coordinates for d4dcfa_:

Click to download the PDB-style file with coordinates for d4dcfa_.
(The format of our PDB-style files is described here.)

Timeline for d4dcfa_: