![]() | Class g: Small proteins [56992] (92 folds) |
![]() | Fold g.8: BPTI-like [57361] (1 superfamily) disulfide-rich alpha+beta fold |
![]() | Superfamily g.8.1: BPTI-like [57362] (4 families) ![]() |
![]() | Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins) |
![]() | Protein automated matches [190046] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186911] (4 PDB entries) |
![]() | Domain d4dtgk_: 4dtg K: [195176] Other proteins in same PDB: d4dtgl1, d4dtgl2 automated match to d1adza_ complexed with gol, mes, pge |
PDB Entry: 4dtg (more details), 1.8 Å
SCOPe Domain Sequences for d4dtgk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dtgk_ g.8.1.1 (K:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ekpdfcfleedpgicrgyitryfynnqtkqcerfkyggclgnmnnfetleecknicedgh
Timeline for d4dtgk_: