Lineage for d4dtgk_ (4dtg K:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1962426Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 1962427Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 1962428Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)
  6. 1962618Protein automated matches [190046] (3 species)
    not a true protein
  7. 1962649Species Human (Homo sapiens) [TaxId:9606] [186911] (4 PDB entries)
  8. 1962650Domain d4dtgk_: 4dtg K: [195176]
    Other proteins in same PDB: d4dtgl1, d4dtgl2
    automated match to d1adza_
    complexed with gol, mes, pge

Details for d4dtgk_

PDB Entry: 4dtg (more details), 1.8 Å

PDB Description: hemostatic effect of a monoclonal antibody mab 2021 blocking the interaction between fxa and tfpi in a rabbit hemophilia model
PDB Compounds: (K:) tissue factor pathway inhibitor

SCOPe Domain Sequences for d4dtgk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dtgk_ g.8.1.1 (K:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ekpdfcfleedpgicrgyitryfynnqtkqcerfkyggclgnmnnfetleecknicedgh

SCOPe Domain Coordinates for d4dtgk_:

Click to download the PDB-style file with coordinates for d4dtgk_.
(The format of our PDB-style files is described here.)

Timeline for d4dtgk_: