| Class g: Small proteins [56992] (90 folds) |
| Fold g.8: BPTI-like [57361] (1 superfamily) disulfide-rich alpha+beta fold |
Superfamily g.8.1: BPTI-like [57362] (4 families) ![]() |
| Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins) |
| Protein automated matches [190046] (3 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [186911] (4 PDB entries) |
| Domain d4dtgk_: 4dtg K: [195176] automated match to d1adza_ complexed with gol, mes, pge |
PDB Entry: 4dtg (more details), 1.8 Å
SCOPe Domain Sequences for d4dtgk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dtgk_ g.8.1.1 (K:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ekpdfcfleedpgicrgyitryfynnqtkqcerfkyggclgnmnnfetleecknicedgh
Timeline for d4dtgk_: