SCOPe 2.02: Domain d4emkb_: 4emk B:

Lineage for d4emkb_ (4emk B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.38: Sm-like fold [50181] (5 superfamilies)
   core: barrel, open; n*=4, S*=8; meander; SH3-like topology

4. Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families)

5. Family b.38.1.0: automated matches [191538] (1 protein)
   not a true family

6. Protein automated matches [190914] (4 species)
   not a true protein

7. Species Schizosaccharomyces pombe [TaxId:284812] [189773] (3 PDB entries)

8. Domain d4emkb_: 4emk B: [195159]
   automated match to d3swnq_

Details for d4emkb_

PDB Entry: 4emk, 2.3 Å

PDB Description: Crystal structure of SpLsm5/6/7

PDB Compounds: (B:) U6 snRNA-associated Sm-like protein LSm6

SCOPe Domain Sequences for d4emkb_:

Sequence; same for both SEQRES and ATOM records:

>d4emkb_ b.38.1.0 (B:) automated matches {Schizosaccharomyces pombe [TaxId: 284812]}
mdsspneflnkvigkkvlirlssgvdykgilscldgymnlalerteeyvngkktnvygda
firgnnvlyvsal

Timeline for d4emkb_:

• d4emkb_ is new in SCOPe 2.02-stable
  
• d4emkb_ appears in SCOPe 2.03
  
• d4emkb_ appears in the current release, SCOPe 2.08