Lineage for d4f66a_ (4f66 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1818156Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1820295Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 1820296Protein automated matches [190075] (72 species)
    not a true protein
  7. 1820733Species Streptococcus mutans [TaxId:1309] [195139] (2 PDB entries)
  8. 1820734Domain d4f66a_: 4f66 A: [195141]
    automated match to d3qoma_
    complexed with bg6, edo, fmt

Details for d4f66a_

PDB Entry: 4f66 (more details), 1.48 Å

PDB Description: the crystal structure of 6-phospho-beta-glucosidase from streptococcus mutans ua159 in complex with beta-d-glucose-6-phosphate.
PDB Compounds: (A:) Putative phospho-beta-glucosidase

SCOPe Domain Sequences for d4f66a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f66a_ c.1.8.0 (A:) automated matches {Streptococcus mutans [TaxId: 1309]}
amsklpenflwggavaahqleggwqeggkgisvadvmtagrhgvareitagvlegkyypn
heaidfyhhykedvklfaemgfkcfrtsiawtrifpkgdeaepneaglqfyddlfdeclk
ygiepvvtlshfelpyhlvteyggftnrkvidffvhfaevcfrrykdkvkywmtfneinn
qanyqedfapftnsgivykegddreaimyqaahyelvasaravkighainpnlnigcmva
mcpiypatcnpkdilmaqkamqkryyfadvhvhgfypehifkywerkaikvdfterdkkd
lfegtvdyigfsyymsfvidahrennpyydyletedlvknpyvkasdwdwqidpqglrya
lnwftdmyhlplfivengfgaidqveadgmvhddyridylgahikemikavdedgvelmg
ytpwgcidlvsagtgemrkrygfiyvdkddegkgtlkrspklsfnwykeviasngddi

SCOPe Domain Coordinates for d4f66a_:

Click to download the PDB-style file with coordinates for d4f66a_.
(The format of our PDB-style files is described here.)

Timeline for d4f66a_: