Lineage for d1poa__ (1poa -)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 286043Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulphide-linked, and a calcium-binding loop
  4. 286044Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 286049Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)
  6. 286123Protein Snake phospholipase A2 [48624] (27 species)
  7. 286236Species Taiwan cobra (Naja naja atra) [TaxId:8656] [48625] (2 PDB entries)
  8. 286237Domain d1poa__: 1poa - [19514]
    complexed with ca

Details for d1poa__

PDB Entry: 1poa (more details), 1.5 Å

PDB Description: interfacial catalysis: the mechanism of phospholipase a2

SCOP Domain Sequences for d1poa__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1poa__ a.133.1.2 (-) Snake phospholipase A2 {Taiwan cobra (Naja naja atra)}
nlyqfknmiqctvpsrswwdfadygcycgrggsgtpvddldrccqvhdncyneaekisgc
wpyfktysyecsqgtltckggnnacaaavcdcdrlaaicfagapyndndyninlkarc

SCOP Domain Coordinates for d1poa__:

Click to download the PDB-style file with coordinates for d1poa__.
(The format of our PDB-style files is described here.)

Timeline for d1poa__: