Lineage for d3bb4a_ (3bb4 A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1162955Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1162956Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1163638Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1164515Protein automated matches [190047] (16 species)
    not a true protein
  7. 1164732Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188355] (9 PDB entries)
  8. 1164744Domain d3bb4a_: 3bb4 A: [195136]
    automated match to d3bb3a_
    complexed with gnp, mg

Details for d3bb4a_

PDB Entry: 3bb4 (more details), 2.85 Å

PDB Description: crystal structure of toc33 from arabidopsis thaliana in complex with mg2+ and gmppnp
PDB Compounds: (A:) T7I23.11 protein

SCOPe Domain Sequences for d3bb4a_:

Sequence, based on SEQRES records: (download)

>d3bb4a_ c.37.1.8 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ewvgfqqfpaatqeklieffgklkqkdmnsmtvlvlgkggvgksstvnsligeqvvrvsp
fqaeglrpvmvsrtmggftiniidtpglveagyvnhqalelikgflvnrtidvllyvdrl
dvyrvdeldkqvviaitqtfgkeiwcktllvlthaqfsppdelsyetfsskrsdellkti
ragskmrkqefedsaiavvyaensgrcskndkdekalpngeawipnlvkaitdvatnqrk
aihv

Sequence, based on observed residues (ATOM records): (download)

>d3bb4a_ c.37.1.8 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ewvgfqqfpaatqeklieffgklkqkdmnsmtvlvlgkggvgksstvnsligeqvvrvsp
flrpvmvsrtmggftiniidtpglveagyvnhqalelikgflvnrtidvllyvdrldvyr
vdeldkqvviaitqtfgkeiwcktllvlthaqfsppdelsyetfsskrsdellktirags
kmrkqefedsaiavvyaensgrcskndkdekalpngeawipnlvkaitdvatnqrkaihv

SCOPe Domain Coordinates for d3bb4a_:

Click to download the PDB-style file with coordinates for d3bb4a_.
(The format of our PDB-style files is described here.)

Timeline for d3bb4a_: