SCOPe 2.02: Domain d3sa1a_: 3sa1 A:

Lineage for d3sa1a_ (3sa1 A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.0: automated matches [191485] (1 protein)
   not a true family

6. Protein automated matches [190777] (8 species)
   not a true protein

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188674] (19 PDB entries)

8. Domain d3sa1a_: 3sa1 A: [195133]
   automated match to d3jwma_
   complexed with 6dr, nap

Details for d3sa1a_

PDB Entry: 3sa1, 2.5 Å

PDB Description: Bacuills anthracis Dihydrofolate Reductase bound propargyl-linked TMP analog, UCP1021

PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d3sa1a_:

Sequence; same for both SEQRES and ATOM records:

>d3sa1a_ c.71.1.0 (A:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
hhmrvsfmvamdenrvigkdnnlpwrlpselqyvkkttmghplimgrknyeaigrplpgr
rniivtrnegyhvegcevahsveevfelckneeeififggaqiydlflpyvdklyitkih
hafegdtffpemdmtnwkevfvekgltdeknpytyyyhvyekqq

Timeline for d3sa1a_:

• d3sa1a_ is new in SCOPe 2.02-stable
  
• d3sa1a_ appears in SCOPe 2.03
  
• d3sa1a_ appears in the current release, SCOPe 2.08, called d3sa1a1