SCOPe 2.02: Domain d3saia_: 3sai A:

Lineage for d3saia_ (3sai A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.0: automated matches [191485] (1 protein)
   not a true family

6. Protein automated matches [190777] (8 species)
   not a true protein

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188674] (19 PDB entries)

8. Domain d3saia_: 3sai A: [195129]
   automated match to d3jwma_
   complexed with 9dr, nap, ni, peg

Details for d3saia_

PDB Entry: 3sai, 2.25 Å

PDB Description: Bacuills anthracis Dihydrofolate Reductase bound to propargyl-linked TMP analog, UCP1015

PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d3saia_:

Sequence; same for both SEQRES and ATOM records:

>d3saia_ c.71.1.0 (A:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
hhhmrvsfmvamdenrvigkdnnlpwrlpselqyvkkttmghplimgrknyeaigrplpg
rrniivtrnegyhvegcevahsveevfelckneeeififggaqiydlflpyvdklyitki
hhafegdtffpemdmtnwkevfvekgltdeknpytyyyhvyekqq

Timeline for d3saia_:

• d3saia_ is new in SCOPe 2.02-stable
  
• d3saia_ appears in SCOPe 2.03
  
• d3saia_ appears in the current release, SCOPe 2.08, called d3saia1