SCOPe 2.05: Domain d3v4mb_: 3v4m B:

Lineage for d3v4mb_ (3v4m B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (68 proteins)

6. Protein automated matches [190332] (4 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188825] (3 PDB entries)

8. Domain d3v4mb_: 3v4m B: [195127]
   automated match to d1o0pa_
   complexed with cl, na

Details for d3v4mb_

PDB Entry: 3v4m, 1.8 Å

PDB Description: crystal structure of a rna binding domain of a u2 small nuclear ribonucleoprotein auxiliary factor 2 (u2af) from mus musculus at 1.80 a resolution

PDB Compounds: (B:) splicing factor u2af 65 kda subunit

SCOPe Domain Sequences for d3v4mb_:

Sequence; same for both SEQRES and ATOM records:

>d3v4mb_ d.58.7.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ghptevlclmnmvlpeellddeeyeeivedvrdecskyglvksieiprpvdgvevpgcgk
ifveftsvfdcqkamqgltgrkfanrvvvtkycdpdsyhrrdfw

Timeline for d3v4mb_:

• d3v4mb_ first appeared in SCOPe 2.02
  
• d3v4mb_ appears in SCOPe 2.04
  
• d3v4mb_ appears in SCOPe 2.06
  
• d3v4mb_ appears in the current release, SCOPe 2.08