Lineage for d1dvea_ (1dve A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 361144Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 361145Superfamily a.132.1: Heme oxygenase-like [48613] (4 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 361146Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (2 proteins)
  6. 361155Protein Heme oxygenase-1 (HO-1) [48615] (2 species)
  7. 361177Species Rat (Rattus norvegicus) [TaxId:10116] [48617] (9 PDB entries)
  8. 361186Domain d1dvea_: 1dve A: [19512]
    complexed with hem

Details for d1dvea_

PDB Entry: 1dve (more details), 2.4 Å

PDB Description: crystal structure of rat heme oxygenase-1 in complex with heme

SCOP Domain Sequences for d1dvea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dvea_ a.132.1.1 (A:) Heme oxygenase-1 (HO-1) {Rat (Rattus norvegicus)}
sqdlsealkeatkevhiraensefmrnfqkgqvsregfklvmaslyhiytaleeeiernk
qnpvyaplyfpeelhrraaleqdmafwygphwqeaipytpatqhyvkrlhevggthpell
vahaytrylgdlsggqvlkkiaqkamalpssgeglafftfpsidnptkfkqlyrarmntl
emtpevkhrvteeaktafllnielfeelqallte

SCOP Domain Coordinates for d1dvea_:

Click to download the PDB-style file with coordinates for d1dvea_.
(The format of our PDB-style files is described here.)

Timeline for d1dvea_: