Class a: All alpha proteins [46456] (202 folds) |
Fold a.132: Heme oxygenase-like [48612] (1 superfamily) multihelical; bundle |
Superfamily a.132.1: Heme oxygenase-like [48613] (4 families) duplication: contains two structural repeats of 3-helical motif |
Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (2 proteins) |
Protein Heme oxygenase-1 (HO-1) [48615] (2 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [48617] (9 PDB entries) |
Domain d1dvgb_: 1dvg B: [19511] complexed with hem; mutant |
PDB Entry: 1dvg (more details), 2.2 Å
SCOP Domain Sequences for d1dvgb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dvgb_ a.132.1.1 (B:) Heme oxygenase-1 (HO-1) {Rat (Rattus norvegicus)} sqdlsealkeatkevhiraensefmrnfqkgqvsregfklvtaslyhiytaleeeiernk qnpvyaplyfpeelhrraaleqdlafwygphwqeaipytpatqhyvkrlhevggthpell vahaytrylgdlsggqvlkkiaqkalalpssgeglasftfpsidnptkfkqlyrarmntl eltpevkhrvteeaktafllnielfeelqallte
Timeline for d1dvgb_: