Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (92 species) not a true protein |
Species Campylobacter jejuni [TaxId:32022] [195104] (2 PDB entries) |
Domain d4etsb1: 4ets B:102-254 [195105] Other proteins in same PDB: d4etsb2 automated match to d2xigc_ complexed with cl, zn |
PDB Entry: 4ets (more details), 2.1 Å
SCOPe Domain Sequences for d4etsb1:
Sequence, based on SEQRES records: (download)
>d4etsb1 a.4.5.0 (B:102-254) automated matches {Campylobacter jejuni [TaxId: 32022]} lienveydvllerfkkilrqgglkytkqrevllktlyhsdthytpeslymeikqaepdln vgiatvyrtlnlleeaemvtsisfgsagkkyelankphhdhmickncgkiiefenpiier qqaliakehgfkltghlmqlygvcgdcnnqkak
>d4etsb1 a.4.5.0 (B:102-254) automated matches {Campylobacter jejuni [TaxId: 32022]} lienveydvllerfkytkqrevllktlyhsdthytpeslymeikqaepdlnvgiatvyrt lnlleeaemvtsisfgsagkkyelankphhdhmickncgkiiefenpiierqqaliakeh gfkltghlmqlygvcgdcnnqkak
Timeline for d4etsb1: