Lineage for d4etsb1 (4ets B:102-254)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2694639Species Campylobacter jejuni [TaxId:32022] [195104] (2 PDB entries)
  8. 2694642Domain d4etsb1: 4ets B:102-254 [195105]
    Other proteins in same PDB: d4etsb2
    automated match to d2xigc_
    complexed with cl, zn

Details for d4etsb1

PDB Entry: 4ets (more details), 2.1 Å

PDB Description: Crystal structure of Campylobacter jejuni ferric uptake regulator
PDB Compounds: (B:) ferric uptake regulation protein

SCOPe Domain Sequences for d4etsb1:

Sequence, based on SEQRES records: (download)

>d4etsb1 a.4.5.0 (B:102-254) automated matches {Campylobacter jejuni [TaxId: 32022]}
lienveydvllerfkkilrqgglkytkqrevllktlyhsdthytpeslymeikqaepdln
vgiatvyrtlnlleeaemvtsisfgsagkkyelankphhdhmickncgkiiefenpiier
qqaliakehgfkltghlmqlygvcgdcnnqkak

Sequence, based on observed residues (ATOM records): (download)

>d4etsb1 a.4.5.0 (B:102-254) automated matches {Campylobacter jejuni [TaxId: 32022]}
lienveydvllerfkytkqrevllktlyhsdthytpeslymeikqaepdlnvgiatvyrt
lnlleeaemvtsisfgsagkkyelankphhdhmickncgkiiefenpiierqqaliakeh
gfkltghlmqlygvcgdcnnqkak

SCOPe Domain Coordinates for d4etsb1:

Click to download the PDB-style file with coordinates for d4etsb1.
(The format of our PDB-style files is described here.)

Timeline for d4etsb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4etsb2
View in 3D
Domains from other chains:
(mouse over for more information)
d4etsa_