Lineage for d3rksb_ (3rks B:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1178944Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1178945Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1179956Family c.69.1.20: Hydroxynitrile lyase-like [53585] (3 proteins)
  6. 1179957Protein Hydroxynitrile lyase [53586] (2 species)
  7. 1179958Species Cassava (Manihot esculenta) [TaxId:3983] [53588] (9 PDB entries)
  8. 1179973Domain d3rksb_: 3rks B: [195095]
    automated match to d1dwoa_
    complexed with gol; mutant

Details for d3rksb_

PDB Entry: 3rks (more details), 2.5 Å

PDB Description: Crystal Structure of the Manihot esculenta Hydroxynitrile Lyase (MeHNL) K176P mutant
PDB Compounds: (B:) Hydroxynitrilase

SCOPe Domain Sequences for d3rksb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rksb_ c.69.1.20 (B:) Hydroxynitrile lyase {Cassava (Manihot esculenta) [TaxId: 3983]}
mvtahfvlihtichgawiwhklkpaleraghkvtaldmaasgidprqieqinsfdeysep
lltfleklpqgekviivgescaglniaiaadryvdkiaagvfhnsllpdtvhspsytvek
llesfpdwrdteyftftnitgetittmklgfvllrenlftkctdgeyelakmvmrpgslf
qnvlaqrpkftekgygsikkvyiwtdqdkiflpdfqrwqianykpdkvyqvqggdhklql
tkteevahilqevadaya

SCOPe Domain Coordinates for d3rksb_:

Click to download the PDB-style file with coordinates for d3rksb_.
(The format of our PDB-style files is described here.)

Timeline for d3rksb_: