Lineage for d1qq8b_ (1qq8 B:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 101395Fold a.132: Heme oxygenase [48612] (1 superfamily)
  4. 101396Superfamily a.132.1: Heme oxygenase [48613] (2 families) (S)
  5. 101397Family a.132.1.1: Eukaryotic heme oxygenase [48614] (1 protein)
  6. 101398Protein Heme oxygenase-1 (HO-1) [48615] (2 species)
  7. 101399Species Human (Homo sapiens) [TaxId:9606] [48616] (1 PDB entry)
  8. 101401Domain d1qq8b_: 1qq8 B: [19509]

Details for d1qq8b_

PDB Entry: 1qq8 (more details), 2.08 Å

PDB Description: x-ray crystal structure of human heme oxygenase-1 (ho-1) in complex with its substrate heme

SCOP Domain Sequences for d1qq8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qq8b_ a.132.1.1 (B:) Heme oxygenase-1 (HO-1) {Human (Homo sapiens)}
pqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
vahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsl
emtpavrqrvieeaktafllniqlfeelqellth

SCOP Domain Coordinates for d1qq8b_:

Click to download the PDB-style file with coordinates for d1qq8b_.
(The format of our PDB-style files is described here.)

Timeline for d1qq8b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qq8a_