SCOPe 2.02: Domain d3tt4a_: 3tt4 A:

Lineage for d3tt4a_ (3tt4 A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein automated matches [190182] (2 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [192587] (12 PDB entries)

8. Domain d3tt4a_: 3tt4 A: [195086]
   automated match to d1i76a_
   complexed with ca, e1s, mes, zn

Details for d3tt4a_

PDB Entry: 3tt4, 1.88 Å

PDB Description: human mmp8 in complex with l-glutamate motif inhibitor

PDB Compounds: (A:) Neutrophil collagenase

SCOPe Domain Sequences for d3tt4a_:

Sequence; same for both SEQRES and ATOM records:

>d3tt4a_ d.92.1.11 (A:) automated matches {Homo sapiens [TaxId: 9606]}
gnpkwertnltyrirnytpqlseaeveraikdafelwsvaspliftrisqgeadiniafy
qrdhgdnspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahefghsl
glahssdpgalmypnyafretsnyslpqddidgiqaiyg

Timeline for d3tt4a_:

• d3tt4a_ is new in SCOPe 2.02-stable
  
• d3tt4a_ appears in SCOPe 2.03
  
• d3tt4a_ appears in the current release, SCOPe 2.08