SCOPe 2.02: Domain d4asui_: 4asu I:

Lineage for d4asui_ (4asu I:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold

4. Superfamily a.137.8: Epsilon subunit of mitochondrial F1F0-ATP synthase [48690] (1 family)

5. Family a.137.8.1: Epsilon subunit of mitochondrial F1F0-ATP synthase [48691] (2 proteins)

6. Protein automated matches [190373] (1 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [187216] (4 PDB entries)

8. Domain d4asui_: 4asu I: [195069]
   Other proteins in same PDB: d4asug_
   automated match to d1e79i_
   complexed with adp, mg

Details for d4asui_

PDB Entry: 4asu, 2.6 Å

PDB Description: F1-ATPase in which all three catalytic sites contain bound nucleotide, with magnesium ion released in the Empty site

PDB Compounds: (I:) ATP synthase subunit epsilon, mitochondrial

SCOPe Domain Sequences for d4asui_:

Sequence, based on SEQRES records:

>d4asui_ a.137.8.1 (I:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
syirysqicakavrdalktefkanamktsgstikivkv

Sequence, based on observed residues (ATOM records):

>d4asui_ a.137.8.1 (I:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
syirysqicakavrdatikivkv

Timeline for d4asui_:

• d4asui_ is new in SCOPe 2.02-stable
  
• d4asui_ appears in SCOPe 2.03
  
• d4asui_ appears in the current release, SCOPe 2.08