Lineage for d3selx_ (3sel X:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1099891Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 1099892Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 1099893Family a.138.1.1: Cytochrome c3-like [48696] (5 proteins)
  6. 1099971Protein automated matches [190934] (2 species)
    not a true protein
  7. 1099975Species Geobacter sulfurreducens [TaxId:35554] [189147] (13 PDB entries)
  8. 1099988Domain d3selx_: 3sel X: [195042]
    automated match to d1os6a_
    complexed with dxc, hem, so4; mutant

Details for d3selx_

PDB Entry: 3sel (more details), 2.1 Å

PDB Description: ppca m58n mutant
PDB Compounds: (X:) cytochrome c7

SCOPe Domain Sequences for d3selx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3selx_ a.138.1.1 (X:) automated matches {Geobacter sulfurreducens [TaxId: 35554]}
addivlkakngdvkfphkahqkavpdckkchekgpgkiegfgkemahgkgckgcheenkk
gptkcgechkk

SCOPe Domain Coordinates for d3selx_:

Click to download the PDB-style file with coordinates for d3selx_.
(The format of our PDB-style files is described here.)

Timeline for d3selx_: