SCOPe 2.03: Domain d4f3rc_: 4f3r C:

Lineage for d4f3rc_ (4f3r C:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.0: automated matches [191377] (1 protein)
   not a true family

6. Protein automated matches [190459] (31 species)
   not a true protein

7. Species Coxiella burnetii [TaxId:227377] [195012] (1 PDB entry)

8. Domain d4f3rc_: 4f3r C: [195013]
   automated match to d3l93a_
   complexed with ca

Details for d4f3rc_

PDB Entry: 4f3r, 2.25 Å

PDB Description: structure of phosphopantetheine adenylyltransferase (cbu_0288) from coxiella burnetii

PDB Compounds: (C:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d4f3rc_:

Sequence, based on SEQRES records:

>d4f3rc_ c.26.1.0 (C:) automated matches {Coxiella burnetii [TaxId: 227377]}
mkpiaiypgtfdpltnghvdiieralplfnkiivacaptsrkdphlkleervnliadvlt
dervevlpltgllvdfakthqanfilrglravsdfdyefqlahmnyqlspeietiflpar
egysyvsgtmvreivtlggdvspfvpplvarhlq

Sequence, based on observed residues (ATOM records):

>d4f3rc_ c.26.1.0 (C:) automated matches {Coxiella burnetii [TaxId: 227377]}
mkpiaiypgtfdpltnghvdiieralplfnkiivacaptkleervnliadvltdervevl
pltgllvdfakthqanfilrglravsdfdyefqlahmnyqlspeietiflparegysyvs
gtmvreivtlggdvspfvpplvarhlq

Timeline for d4f3rc_:

• d4f3rc_ first appeared in SCOPe 2.02
  
• d4f3rc_ appears in SCOPe 2.04
  
• d4f3rc_ appears in the current release, SCOPe 2.08