SCOPe 2.02: Domain d3sp7a_: 3sp7 A:

Lineage for d3sp7a_ (3sp7 A:)

1. Root: SCOPe 2.02

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein Apoptosis regulator Bcl-xL [56856] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56857] (24 PDB entries)

8. Domain d3sp7a_: 3sp7 A: [195002]
   automated match to d2o1ya1
   complexed with 03b, act, zn

Details for d3sp7a_

PDB Entry: 3sp7, 1.4 Å

PDB Description: crystal structure of bcl-xl bound to bm903

PDB Compounds: (A:) Bcl-2-like protein 1

SCOPe Domain Sequences for d3sp7a_:

Sequence, based on SEQRES records:

>d3sp7a_ f.1.4.1 (A:) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]}
sefmsqsnrelvvdflsyklsqkgyswsqfsdveenrteapegteseavkqalreagdef
elryrrafsdltsqlhitpgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdk
emqvlvsriaawmatylndhlepwiqenggwdtfvelygnna

Sequence, based on observed residues (ATOM records):

>d3sp7a_ f.1.4.1 (A:) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]}
sefmsqsnrelvvdflsyklsqkgyswsqfsdeseavkqalreagdefelryrrafsdlt
sqlhitpgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaaw
matylndhlepwiqenggwdtfvelygnna

Timeline for d3sp7a_:

• d3sp7a_ is new in SCOPe 2.02-stable
  
• d3sp7a_ appears in SCOPe 2.03
  
• d3sp7a_ appears in the current release, SCOPe 2.08, called d3sp7a1