SCOPe 2.02: Domain d3tolb_: 3tol B:

Lineage for d3tolb_ (3tol B:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.3: Cytochromes [47175] (2 families)
   Heme-containing proteins

5. Family a.24.3.1: Cytochrome b562 [47176] (2 proteins)

6. Protein automated matches [190502] (1 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187450] (25 PDB entries)

8. Domain d3tolb_: 3tol B: [194998]
   automated match to d3de8a_
   complexed with ca, hem, zn

Details for d3tolb_

PDB Entry: 3tol, 2 Å

PDB Description: Crystal structure of an engineered cytochrome cb562 that forms 1D, Zn-mediated coordination polymers

PDB Compounds: (B:) Soluble cytochrome b562

SCOPe Domain Sequences for d3tolb_:

Sequence; same for both SEQRES and ATOM records:

>d3tolb_ a.24.3.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
adlednmetlndnlkviekadnaaqvekalekmlaaaadalkatppkledkspdspemrd
frhgfailmgqihdaahlanegkvkeaqaaaeqlkttcnachqkyr

Timeline for d3tolb_:

• d3tolb_ is new in SCOPe 2.02-stable
  
• d3tolb_ appears in SCOPe 2.03
  
• d3tolb_ appears in the current release, SCOPe 2.08