SCOPe 2.06: Domain d2q6ma1: 2q6m A:427-628

Lineage for d2q6ma1 (2q6m A:427-628)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.0: automated matches [191650] (1 protein)
   not a true family

6. Protein automated matches [191197] (9 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:666] [189511] (11 PDB entries)

8. Domain d2q6ma1: 2q6m A:427-628 [194982]
   Other proteins in same PDB: d2q6ma2
   automated match to d3ki3a_
   complexed with p34

Details for d2q6ma1

PDB Entry: 2q6m, 1.25 Å

PDB Description: catalytic fragment of cholix toxin from vibrio cholerae in complex with the pj34 inhibitor

PDB Compounds: (A:) Cholix toxin

SCOPe Domain Sequences for d2q6ma1:

Sequence, based on SEQRES records:

>d2q6ma1 d.166.1.0 (A:427-628) automated matches {Vibrio cholerae [TaxId: 666]}
avitpqgvtnwtyqeleathqaltregyvfvgyhgtnhvaaqtivnriapvprgnntene
ekwgglyvathaevahgyarikegtgeyglptraerdargvmlrvyipraslerfyrtnt
plenaeehitqvighslplrneaftgpesaggedetvigwdmaihavaipstipgnayee
laideeavakeqsistkppyke

Sequence, based on observed residues (ATOM records):

>d2q6ma1 d.166.1.0 (A:427-628) automated matches {Vibrio cholerae [TaxId: 666]}
avitpqgvtnwtyqeleathqaltregyvfvgyhgtnhvaaqtivnriapvteneekwgg
lyvathaevahgyarikegtgeyglptraerdargvmlrvyipraslerfyrtntplena
eehitqvighslplrneaftgpesaggedetvigwdmaihavaipstipgnayeelaide
eavakeqsistkppyke

Timeline for d2q6ma1:

• d2q6ma1 first appeared in SCOPe 2.02, called d2q6ma_
  
• d2q6ma1 was called d2q6ma_ in SCOPe 2.05
  
• d2q6ma1 appears in SCOPe 2.07
  
• d2q6ma1 appears in the current release, SCOPe 2.08