SCOPe 2.03: Domain d3u7be_: 3u7b E:

Lineage for d3u7be_ (3u7b E:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (46 species)
   not a true protein

7. Species Fungus (Fusarium oxysporum) [TaxId:5507] [194927] (1 PDB entry)

8. Domain d3u7be_: 3u7b E: [194931]
   automated match to d1v6ya_
   complexed with edo

Details for d3u7be_

PDB Entry: 3u7b, 1.94 Å

PDB Description: a new crystal structure of a fusarium oxysporum gh10 xylanase reveals the presence of an extended loop on top of the catalytic cleft

PDB Compounds: (E:) endo-1,4-beta-xylanase

SCOPe Domain Sequences for d3u7be_:

Sequence; same for both SEQRES and ATOM records:

>d3u7be_ c.1.8.0 (E:) automated matches {Fungus (Fusarium oxysporum) [TaxId: 5507]}
aasgleaamkaagkqyfgtaltvrndqgeidiinnkneigsitpenamkweaiqpnrgqf
nwgpadqhaaaatsrgyelrchtlvwhsqlpswvangnwnnqtlqavmrdhinavmgryr
gkcthwdvvnealnedgtyrdsvflrvigeayipiafrmalaadpttklyyndynleygn
aktegakriarlvksyglridgiglqahmtsestptqntptpsraklasvlqgladlgvd
vayteldirmntpatqqklqtnadayarivgscmdvkrcvgitvwgisdkyswvpgtfpg
egsallwndnfqkkpsytstlntinr

Timeline for d3u7be_:

• d3u7be_ first appeared in SCOPe 2.02
  
• d3u7be_ appears in SCOPe 2.04
  
• d3u7be_ appears in the current release, SCOPe 2.08