SCOPe 2.05: Domain d4ap4b_: 4ap4 B:

Lineage for d4ap4b_ (4ap4 B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein automated matches [190124] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186848] (39 PDB entries)

8. Domain d4ap4b_: 4ap4 B: [194914]
   Other proteins in same PDB: d4ap4c_, d4ap4f_
   automated match to d2c4pb_
   complexed with zn

Details for d4ap4b_

PDB Entry: 4ap4, 2.21 Å

PDB Description: rnf4 - ubch5a - ubiquitin heterotrimeric complex

PDB Compounds: (B:) ubiquitin-conjugating enzyme e2 d1

SCOPe Domain Sequences for d4ap4b_:

Sequence; same for both SEQRES and ATOM records:

>d4ap4b_ d.20.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsgsmalkriqkelsdlqrdppahcragpvgddlfhwqatimgppdsayqggvffltvhf
ptdypfkppkiafttkiyhpninsngsikldilrsqwspaltvskvllsicsllcdpnpd
dplvpdiaqiyksdkekynrharewtqkyam

Timeline for d4ap4b_:

• d4ap4b_ first appeared in SCOPe 2.02
  
• d4ap4b_ appears in SCOPe 2.04
  
• d4ap4b_ is called d4ap4b1 in SCOPe 2.06
  
• d4ap4b_ appears in the current release, SCOPe 2.08, called d4ap4b1