Lineage for d4b2ab_ (4b2a B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1201702Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily)
    alpha+beta sandwich; loop across free side of beta-sheet
  4. 1201703Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (2 families) (S)
  5. 1201704Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (5 proteins)
  6. 1201757Protein automated matches [190792] (2 species)
    not a true protein
  7. 1201760Species Hirudo medicinalis [TaxId:6421] [193615] (4 PDB entries)
  8. 1201765Domain d4b2ab_: 4b2a B: [194886]
    Other proteins in same PDB: d4b2aa_, d4b2ac_
    automated match to d1egla_
    complexed with ca, edo, gol

Details for d4b2ab_

PDB Entry: 4b2a (more details), 1.89 Å

PDB Description: structure of the factor xa-like trypsin variant triple-ala (tga) in complex with eglin c
PDB Compounds: (B:) eglin c

SCOPe Domain Sequences for d4b2ab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4b2ab_ d.40.1.1 (B:) automated matches {Hirudo medicinalis [TaxId: 6421]}
selksfpevvgktvdqareyftlhypqydvyflpegspvtkdlrynrvrvfynpgtnvvn
hvphvg

SCOPe Domain Coordinates for d4b2ab_:

Click to download the PDB-style file with coordinates for d4b2ab_.
(The format of our PDB-style files is described here.)

Timeline for d4b2ab_: