Lineage for d4b2bc_ (4b2b C:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1318222Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1318223Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1318445Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 1319321Protein Trypsin(ogen) [50515] (9 species)
  7. 1319339Species Cow (Bos taurus) [TaxId:9913] [50516] (392 PDB entries)
    Uniprot P00760
  8. 1319384Domain d4b2bc_: 4b2b C: [194879]
    Other proteins in same PDB: d4b2bb_, d4b2bd_
    automated match to d3pwca_
    complexed with ca, cl, edo, gol

Details for d4b2bc_

PDB Entry: 4b2b (more details), 1.36 Å

PDB Description: structure of the factor xa-like trypsin variant triple-ala (tgpa) in complex with eglin c
PDB Compounds: (C:) cationic trypsin

SCOPe Domain Sequences for d4b2bc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4b2bc_ b.47.1.2 (C:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsetynndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksassfiitsnmfcagyleggkdacqgdaggp
vvcsgklqgivswgegcaqknkpgfytkvcnyvswikqtiasn

SCOPe Domain Coordinates for d4b2bc_:

Click to download the PDB-style file with coordinates for d4b2bc_.
(The format of our PDB-style files is described here.)

Timeline for d4b2bc_: