SCOP 1.71: Domain d1grl_1: 1grl 6-136,410-523

Lineage for d1grl_1 (1grl 6-136,410-523)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.129: GroEL equatorial domain-like [48591] (1 superfamily)
   multihelical; 8 helices arranged in 2 parallel layers

4. Superfamily a.129.1: GroEL equatorial domain-like [48592] (2 families)
   duplication: two 4-helical subdomains are related by a pseudo dyad passing through the ATP-binding site

5. Family a.129.1.1: GroEL chaperone, ATPase domain [48593] (1 protein)

6. Protein GroEL, E domain [48594] (4 species)

7. Species Escherichia coli [TaxId:562] [48595] (9 PDB entries)

8. Domain d1grl_1: 1grl 6-136,410-523 [19487]
   Other proteins in same PDB: d1grl_2, d1grl_3
   mutant

Details for d1grl_1

PDB Entry: 1grl, 2.8 Å

PDB Description: the crystal structure of the bacterial chaperonin groel at 2.8 angstroms

SCOP Domain Sequences for d1grl_1:

Sequence; same for both SEQRES and ATOM records:

>d1grl_1 a.129.1.1 (6-136,410-523) GroEL, E domain {Escherichia coli}
vkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareieledk
fenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgidkavt
vaveelkalsvXgvvagggvalirvaskladlrgqnedqnvgikvalrameaplrqivln
cgeepsvvantvkggdgnygynaateeygnmidmgildptkvtrsalqyaasvaglmitt
ecmvtd

Timeline for d1grl_1:

• d1grl_1 first appeared (with stable ids) in SCOP 1.55
  
• d1grl_1 appears in SCOP 1.69
  
• d1grl_1 is called d1grla1 in SCOP 1.73
  
• d1grl_1 appears in the current release, SCOPe 2.08, called d1grla1