Lineage for d4ay9h_ (4ay9 H:)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1242698Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 1242699Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 1242896Family g.17.1.4: Gonadodropin/Follitropin [57528] (4 proteins)
  6. 1242920Protein automated matches [194842] (1 species)
    not a true protein
  7. 1242921Species Homo sapiens [TaxId:9606] [194843] (1 PDB entry)
  8. 1242925Domain d4ay9h_: 4ay9 H: [194844]
    automated match to d1fl7b_
    complexed with nag

Details for d4ay9h_

PDB Entry: 4ay9 (more details), 2.5 Å

PDB Description: structure of follicle-stimulating hormone in complex with the entire ectodomain of its receptor
PDB Compounds: (H:) follitropin subunit beta

SCOPe Domain Sequences for d4ay9h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ay9h_ g.17.1.4 (H:) automated matches {Homo sapiens [TaxId: 9606]}
nsceltnitiaiekeecrfcisinttwcagycytrdlvykdparpkiqktctfkelvyet
vrvpgcahhadslytypvatqchcgkcdsdstdctvrglgpsycsfg

SCOPe Domain Coordinates for d4ay9h_:

Click to download the PDB-style file with coordinates for d4ay9h_.
(The format of our PDB-style files is described here.)

Timeline for d4ay9h_: