Lineage for d1aonk1 (1aon K:2-136,K:410-525)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 285925Fold a.129: GroEL equatorial domain-like [48591] (1 superfamily)
    multihelical; 8 helices arranged in 2 parallel layers
  4. 285926Superfamily a.129.1: GroEL equatorial domain-like [48592] (2 families) (S)
    duplication: two 4-helical subdomains are related by a pseudo dyad passing through the ATP-binding site
  5. 285927Family a.129.1.1: GroEL chaperone, ATPase domain [48593] (1 protein)
  6. 285928Protein GroEL, E domain [48594] (2 species)
  7. 285929Species Escherichia coli [TaxId:562] [48595] (4 PDB entries)
  8. 285961Domain d1aonk1: 1aon K:2-136,K:410-525 [19483]
    Other proteins in same PDB: d1aona2, d1aona3, d1aonb2, d1aonb3, d1aonc2, d1aonc3, d1aond2, d1aond3, d1aone2, d1aone3, d1aonf2, d1aonf3, d1aong2, d1aong3, d1aonh2, d1aonh3, d1aoni2, d1aoni3, d1aonj2, d1aonj3, d1aonk2, d1aonk3, d1aonl2, d1aonl3, d1aonm2, d1aonm3, d1aonn2, d1aonn3, d1aono_, d1aonp_, d1aonq_, d1aonr_, d1aons_, d1aont_, d1aonu_

Details for d1aonk1

PDB Entry: 1aon (more details), 3 Å

PDB Description: crystal structure of the asymmetric chaperonin complex groel/groes/(adp)7

SCOP Domain Sequences for d1aonk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aonk1 a.129.1.1 (K:2-136,K:410-525) GroEL, E domain {Escherichia coli}
aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
kavtaaveelkalsvXgvvagggvalirvaskladlrgqnedqnvgikvalrameaplrq
ivlncgeepsvvantvkggdgnygynaateeygnmidmgildptkvtrsalqyaasvagl
mittecmvtdlp

SCOP Domain Coordinates for d1aonk1:

Click to download the PDB-style file with coordinates for d1aonk1.
(The format of our PDB-style files is described here.)

Timeline for d1aonk1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1aona1, d1aona2, d1aona3, d1aonb1, d1aonb2, d1aonb3, d1aonc1, d1aonc2, d1aonc3, d1aond1, d1aond2, d1aond3, d1aone1, d1aone2, d1aone3, d1aonf1, d1aonf2, d1aonf3, d1aong1, d1aong2, d1aong3, d1aonh1, d1aonh2, d1aonh3, d1aoni1, d1aoni2, d1aoni3, d1aonj1, d1aonj2, d1aonj3, d1aonl1, d1aonl2, d1aonl3, d1aonm1, d1aonm2, d1aonm3, d1aonn1, d1aonn2, d1aonn3, d1aono_, d1aonp_, d1aonq_, d1aonr_, d1aons_, d1aont_, d1aonu_